Source code for ProCheck

# -*- coding: utf-8 -*-
#  Copyright (c) 2016-2017, Zhijiang Yao, Jie Dong and Dongsheng Cao
#  All rights reserved.
#  This file is part of the PyBioMed.
#  The contents are covered by the terms of the BSD license
#  which is included in the file license.txt, found at the root
#  of the PyBioMed source tree.
"""
#####################################################################################
This module is used for checking whether the input protein sequence is valid amino acid

sequence. You can freely use and distribute it. If you hava any problem, you could

contact with us timely!

Authors: Zhijiang Yao and Dongsheng Cao.

Date: 2016.06.04

Email: gadsby@163.com

#####################################################################################

"""

AALetter = [
    "A",
    "R",
    "N",
    "D",
    "C",
    "E",
    "Q",
    "G",
    "H",
    "I",
    "L",
    "K",
    "M",
    "F",
    "P",
    "S",
    "T",
    "W",
    "Y",
    "V",
]


[docs]def ProteinCheck(ProteinSequence): """ ################################################################################### Check whether the protein sequence is a valid amino acid sequence or not Usage: result=ProteinCheck(protein) Input: protein is a pure protein sequence. Output: if the check is no problem, result will return the length of protein. if the check has problems, result will return 0. ################################################################################### """ NumPro = len(ProteinSequence) for i in ProteinSequence: if i not in AALetter: flag = 0 break else: flag = NumPro return flag
if __name__ == "__main__": protein = "ADGCGVGEGTGQGPMCNCMCMKWVYADEDAADLESDSFADEDASLESDSFPWSNQRVFCSFADEDASU" print(ProteinCheck(protein))