Source code for GetSubSeq

# -*- coding: utf-8 -*-
#  Copyright (c) 2016-2017, Zhijiang Yao, Jie Dong and Dongsheng Cao
#  All rights reserved.
#  This file is part of the PyBioMed.
#  The contents are covered by the terms of the BSD license
#  which is included in the file license.txt, found at the root
#  of the PyBioMed source tree.
"""
#####################################################################################

The prediction of functional sites (e.g.,methylation) of proteins usually needs to

split the total protein into a set of segments around specific amino acid. Given a

specific window size p, we can obtain all segments of length equal to (2*p+1) very

easily. Note that the output of the method is a list form. You can freely use and

distribute it. If you have any problem, you could contact with us timely.

Authors: Zhijiang Yao and Dongsheng Cao.

Date: 2016.06.04

Email: gadsby@163.com

#####################################################################################

"""

# Core Library modules
import re
import string

AALetter = [
    "A",
    "R",
    "N",
    "D",
    "C",
    "E",
    "Q",
    "G",
    "H",
    "I",
    "L",
    "K",
    "M",
    "F",
    "P",
    "S",
    "T",
    "W",
    "Y",
    "V",
]


#############################################################################################


def GetSubSequence(ProteinSequence, ToAA="S", window=3):
    """
    #######################################################################
    Get all 2*window+1 sub-sequences whose cener is ToAA in a protein.

    Usage:

    result=GetSubSequence(protein,ToAA,window)

    Input:protein is a pure problem sequence.

    ToAA is the central (query point) amino acid in the sub-sequence.

    window is the span.

    result is a list form containing all satisfied sub-sequences.
    #######################################################################
    """

    if ToAA not in AALetter:
        ToAA = ProteinSequence[1]

    Num = len(ProteinSequence)
    seqiter = re.finditer(ToAA, ProteinSequence)
    AAindex = []
    for i in seqiter:
        AAindex.append(i.end())

    result = []
    for i in AAindex:
        if i - window > 0 and Num - i + 1 - window > 0:
            temp = ProteinSequence[i - window - 1 : i + window]
            result.append(temp)

    return result


#############################################################################################
if __name__ == "__main__":
    protein = "ADGCGVGEGTGQGPMCNCMCMKWVYADEDAADLESDSFADEDASLESDSFPWSNQRVFCSFADEDAS"
    subseq = GetSubSequence(protein, ToAA="D", window=10)
    print(subseq)
    print(len(subseq))